The short version of monohydrate fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-12-03. Anything still debated is marked as such rather than presented as settled.
In chemical terms, creatine monohydrate is often described as N-(aminoiminomethyl)-N-methylglycine monohydrate, though nomenclature varies. Its solid state consists of zwitterionic creatine molecules linked with water through hydrogen bonding. The compound dissolves in water, but dissolution rate depends on particle size, temperature, and agitation. Once dissolved, the hydrate water becomes part of the solvent, leaving free creatine in solution. The monohydrate is not the same as creatine anhydrous, which lacks the water of crystallization and has a higher creatine fraction by mass.
Commercial creatine monohydrate is typically a white to off-white powder with low odor. It is commonly sold as a fine powder, micronized powder, or larger crystals, but these are physical forms of the same chemical. Purity grades vary, and products may contain small amounts of related substances such as creatinine, dicyandiamide, or moisture. The monohydrate is often selected for supplements and research because its production is well established and its behavior in water is predictable. Analytical certificates usually report assay, loss on drying, and heavy metals.
Creatine monohydrate is a crystalline compound formed from creatine and one water molecule in its solid lattice. Creatine itself is a nitrogen-containing organic acid involved in energy transfer in muscle and other tissues. The monohydrate form is the most common solid form used in research and commercial products because it is stable and easy to handle. The term "monohydrate" refers to the fixed one-to-one ratio of water to creatine in the crystal, not to moisture content. This distinction matters when comparing labels or calculating creatine content.
In the body, creatine is obtained from dietary meat and fish and is also synthesized from arginine, glycine, and methionine. Muscle stores creatine and phosphocreatine, which participate in the rapid regeneration of adenosine triphosphate during short, intense activity. The monohydrate form is used in research because it is chemically defined, stable as a dry solid, and relatively inexpensive to produce. Questions remain about whether other creatine forms offer meaningful advantages in absorption or tissue retention, and findings vary across studies and populations.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Creatine itself is a nitrogen-containing organic acid that occurs in vertebrate muscle and other tissues. The monohydrate designation refers to the water included in the crystal lattice, not to water added during manufacturing. Its chemical formula is commonly written as C4H9N3O2·H2O. The solid is typically a white, odorless powder with low solubility in water at room temperature. It is one of several creatine forms described in scientific and commercial literature.
| Property | Value | Notes |
|---|---|---|
| Chemical name | N-(aminoiminomethyl)-N-methylglycine monohydrate | Nomenclature varies across sources. |
| Common synonyms | Creatine hydrate; creatine monohydrate | “Monohydrate” specifies one water per creatine. |
| Appearance | White to off-white crystalline powder | Particle size and flowability vary by grade. |
| Solubility class | Soluble in water; slightly soluble in ethanol | Dissolution increases with temperature and stirring. |
| Typical storage | Tightly closed container at 15–25 °C | Protect from moisture and excessive heat. |
Storage recommendations generally emphasize a cool, dry place away from direct sunlight and strong oxidizers. Sealed containers limit humidity exchange, which helps prevent clumping and gradual conversion to creatinine. Long-term stability studies usually monitor appearance, moisture, and purity at intervals under defined temperature and humidity conditions. Accelerated tests at elevated temperature can reveal degradation pathways, but they do not perfectly predict room-temperature shelf life. Questions remain about how much creatinine formation is acceptable in different product categories and how packaging choices affect that rate over time.
Commercial creatine monohydrate is typically manufactured through chemical synthesis, often starting from sarcosine and cyanamide. The resulting material is crystallized, washed, and dried to a specified hydrate content. Finished lots are tested for identity, purity, moisture, and heavy metals before release. Because the compound can cyclize to creatinine under heat or prolonged storage in solution, manufacturers control temperature and humidity during processing. The solid itself is relatively stable when kept dry and sealed, but moisture uptake can cause caking and complicate accurate assay.
Recommended storage usually involves a sealed container kept at room temperature, away from direct sunlight and moisture. High humidity can cause caking, which changes flow properties and may complicate accurate weighing. Repeated opening of containers exposes the powder to air and moisture, so smaller aliquots can reduce handling effects. Storage temperature ranges are not absolute requirements; they reflect conditions that slow degradation and preserve consistent physical characteristics. Clean, dry tools help prevent contamination during sampling.
Identity and purity are commonly assessed by high-performance liquid chromatography, often with ultraviolet detection, and by spectroscopic techniques such as infrared or nuclear magnetic resonance. These methods can distinguish creatine from creatinine and detect related impurities. Moisture content may be measured by Karl Fischer titration or loss on drying. Particle size, bulk density, and heavy metal limits are additional quality parameters. Not every product is tested by every method, so specifications depend on the intended use and regulatory framework.
Solid creatine monohydrate is generally stable when kept dry and protected from extremes of heat and humidity. In the presence of moisture, it can gradually convert to creatinine, a cyclic dehydration product that has little value for phosphocreatine synthesis. Elevated temperatures and acidic conditions accelerate this conversion in solution. Because the reaction is slow in cool, dry storage, typical shelf lives are measured in years rather than weeks. Packaging that limits moisture and oxygen exposure helps maintain purity.
Handling practices aim to limit moisture uptake and thermal exposure. Containers should stay closed when not in use, and storage areas should avoid direct sunlight, strong heat, and high humidity. Caking can occur when powder absorbs water, even if the creatine itself has not fully degraded. Aqueous stock solutions are best prepared fresh when needed because they are less stable than the solid. Open questions include how different excipients, packaging materials, and climate conditions affect long-term stability across global supply chains.
Solid creatine monohydrate is relatively stable when kept dry and sealed, but heat and moisture accelerate its conversion to creatinine. This degradation involves intramolecular cyclization, a process that removes water and forms a less useful compound for phosphocreatine metabolism. Powder stored under cool, dry conditions can remain within specification for extended periods, though exact shelf life depends on packaging, humidity, and initial purity. Aqueous solutions degrade faster than dry powder, with pH and temperature influencing the rate. Because degradation is gradual, analytical testing is used to confirm potency at manufacture and during stability studies.
Analytical methods for creatine monohydrate focus on identity, purity, and degradation products. High-performance liquid chromatography with ultraviolet detection is common, often at a wavelength near 210 nanometers. Titration and nuclear magnetic resonance spectroscopy can also quantify the parent compound. Pharmacopeial monographs specify tests for appearance, solubility, water content, and related substances, including creatinine. Purity values above 99 percent are typical for pharmaceutical-grade material, though supplement-grade products vary. Independent verification can detect label discrepancies.
Sourcing and verification of creatine monohydrate involve both manufacturing origin and third-party testing. Industrial production commonly starts with sarcosine and cyanamide, followed by crystallization to obtain the monohydrate. Some products are derived from animal sources, while others are synthesized from non-animal precursors. Certificates of analysis report assay, heavy metals, and microbial limits. Regulations differ by country: in the United States it is sold as a dietary supplement, whereas in the European Union it falls under food supplement rules.
The Journal of Biological Chemistry publishes research in any area of biochemistry or molecular biology in one online-only issue per week. Molecular & Cellular Proteomics is a monthly online only publication. Articles appearing in MCP "...describe the structural and functional properties of proteins and their expression, particularly with respect to the developmental time courses of the organism of which they are a part." The journal also publishes other content such as "HUPO views" (reports from the Human Proteome Organization), proceedings from HUPO meetings, and the proceedings of the International Symposium On Mass Spectrometry In The Life Sciences. The Journal of Lipid Research covers "...the science of lipids in health and disease. The Journal emphasizes lipid function and the biochemical and genetic regulation of lipid metabolism. In addition, JLR publishes manuscripts on patient-oriented and epidemiological research relating to altered lipid metabolism, including modification of dietary lipids." ASBMB Today is the society's monthly news magazine. It contains extensive coverage of awards, meetings, research highlights, job placement advertising and human interest articles. All ASBMB members receive a complimentary subscription to ASBMB Today. The online version of the magazine features daily publishing.
Increased blood CRP levels were higher in people with avian flu H7N9 compared to those with H1N1 (more common) influenza, with a review reporting that severe H1N1 influenza had elevated CRP. In 2020, people infected with COVID-19 in Wuhan, China, had elevated CRP. MedlinePlus Encyclopedia: C-reactive protein Inflammation, Heart Disease and Stroke: The Role of C-Reactive Protein (American Heart Association) C-Reactive+Protein at the U.S. National Library of Medicine Medical Subject Headings (MeSH) CRP: analyte monograph - The Association for Clinical Biochemistry and Laboratory Medicine George Vrousgos, N.D. - Southern Cross University Archived 2020-02-18 at the Wayback Machine Human CRP genome location and CRP gene details page in the UCSC Genome Browser. Overview of all the structural information available in the PDB for UniProt: P02741 (C-reactive protein) at the PDBe-KB.
Gs exerts its effects via two pathways. Firstly, it directly opens L-type calcium channels (LTCC) in the plasma membrane. Secondly, it renders adenylate cyclase activated, resulting in an increase of cAMP, activating protein kinase A (PKA) which in turn phosphorylates several targets, such as phospholamban, LTCC, Troponin I (TnI), and potassium channels. The phosphorylation of phospholamban deactivates its own function which normally inhibits SERCA on the sarcoplasmic reticulum (SR) in cardiac myocytes. Due to this, more calcium enters the SR and is therefore available for the next contraction. LTCC phosphorylation increases its open probability and therefore allows more calcium to enter the myocyte upon cell depolarisation. Both of these mechanisms increase the available calcium for contraction and therefore increase inotropy. Conversely, TnI phosphorylation results in its facilitated dissociation of calcium from troponin C (TnC) which speeds the muscle relaxation (positive lusitropy). Potassium channel phosphorylation increases its open probability which results in shorter refractory period (because the cell repolarises faster), also increasing lusitropy. Furthermore, in nodal cells such as in the SA node, cAMP directly binds to and opens the HCN channels, increasing their open probability, which increases chronotropy.
In biochemistry and molecular biology, a binding site is a region on a macromolecule such as a protein that binds to another molecule with specificity. The binding partner of the macromolecule is often referred to as a ligand. Ligands may include other proteins (resulting in a protein–protein interaction), enzyme substrates, second messengers, hormones, or allosteric modulators. The binding event is often, but not always, accompanied by a conformational change that alters the protein's function. Binding to protein binding sites is most often reversible (transient and non-covalent), but can also be covalent reversible or irreversible.
Corin converts the atrial natriuretic peptide (ANP) precursor, pro-ANP, to mature ANP, a cardiac hormone that regulates salt-water balance and blood pressure. In mice, corin deficiency prevents pro-ANP processing and causes salt-sensitive hypertension. Corin may also function as a pro-brain-type natriuretic peptide convertase. Corin-mediated ANP production in the pregnant uterus promotes spiral artery remodeling and trophoblast invasion. CORIN mutations have been reported in patients with preeclampsia. In mice, corin functions in the dermal papilla to regulate coat color in an Agouti-dependent pathway.
Sources: en.wikipedia.org
Amino acids have been considered as components of biodegradable polymers, which have applications as environmentally friendly packaging and in medicine in drug delivery and the construction of prosthetic implants. An interesting example of such materials is polyaspartate, a water-soluble biodegradable polymer that may have applications in disposable diapers and agriculture. Due to its solubility and ability to chelate metal ions, polyaspartate is also being used as a biodegradable antiscaling agent and a corrosion inhibitor. The commercial production of amino acids usually relies on mutant bacteria that overproduce individual amino acids using glucose as a carbon source. Some amino acids are produced by enzymatic conversions of synthetic intermediates. 2-Aminothiazoline-4-carboxylic acid is an intermediate in one industrial synthesis of L-cysteine for example. Aspartic acid is produced by the addition of ammonia to fumarate using a lyase.
Polycondensation involves the formation of polymers through condensation reactions between different species, creating condensation polymers. With automated synthesis, General electric manufactured an approach for melt-polymerizations of BPA and diphenyl carbonate (DPC), using sodium hydroxide (NaOH) as the catalyst. Once the results were analyzed, it was shown that, by using an automated method of polymerization, the effect of varying the catalyst amount became more distinct and improved the reproducibility for the reaction. Furthermore, it demonstrated an increase within the homogeneity of the polymers in the microreactors.
This type of specificity is sensitive to the substrate's optical activity of orientation. Stereochemical molecules differ in the way in which they rotate plane polarized light, or orientations of linkages (see alpha, beta glycosidic linkages). Enzymes that are stereochemically specific will bind substrates with these particular properties. For example, beta-glycosidase will only react with beta-glycosidic bonds which are present in cellulose, but not present in starch and glycogen, which contain alpha-glycosidic linkages. This is relevant in how mammals are able to digest food. For instance, the enzyme Amylase is present in mammal saliva, that is stereo-specific for alpha-linkages, this is why mammals are able to efficiently use starch and glycogen as forms of energy, but not cellulose (because it is a beta-linkage). Specific equilibrium dissociation constant for formation of the enzyme-substrate complex is known as k d {\displaystyle k_{d}}
Arrestins (abbreviated Arr) are a small family of proteins important for regulating signal transduction at G protein-coupled receptors. Arrestins were first discovered in the late '80s as a part of a conserved two-step mechanism for regulating the activity of G protein-coupled receptors (GPCRs) in the visual rhodopsin system by Hermann Kühn, Scott Hall, and Ursula Wilden and in the β-adrenergic system by Martin J. Lohse and co-workers.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Even with all the precautions taken by medical professionals, infection reportedly occurs in up to 13.9% of patients after stabilization of an open fracture, and in about 0.5-2% of patients who receive joint prostheses. To reduce these numbers, the surfaces of the devices used in these procedures have been altered in hopes of preventing the growth of the bacteria that leads to these infections. This has been achieved by coating titanium devices with an antiseptic combination of chlorhexidine and chloroxylenol. This antiseptic combination successfully prevents the growth of the five main organisms that cause medical-related infections, which include Staphylococcus epidermidis, Methicillin-resistant Staphylococcus aureus, Pseudomonas aeruginosa, Escherichia coli and Candida albicans. Peptide-based gel coating with intrinsic antibacterial activity against Methicillin-resistant Staphylococcus aureus, was also shown to inhibit colonization of titanium implants in mice.
FO is a water insoluble protein with eight subunits and a transmembrane ring. The ring has a tetrameric shape with a helix-loop-helix protein that goes through conformational changes when protonated and deprotonated, pushing neighboring subunits to rotate, causing the spinning of FO which then also affects conformation of F1, resulting in switching of states of alpha and beta subunits. The FO region of ATP synthase is a proton pore that is embedded in the mitochondrial membrane. It consists of three main subunits, a, b, and c. Six c subunits make up the rotor ring, and subunit b makes up a stalk connecting to F1 OSCP that prevents the αβ hexamer from rotating. Subunit a connects b to the c ring. Humans have six additional subunits, d, e, f, g, F6, and 8 (or A6L). This part of the enzyme is located in the mitochondrial inner membrane and couples proton translocation to the rotation that causes ATP synthesis in the F1 region. In eukaryotes, mitochondrial FO forms membrane-bending dimers. These dimers self-arrange into long rows at the end of the cristae, possibly the first step of cristae formation. An atomic model for the dimeric yeast FO region was determined by cryo-EM at an overall resolution of 3.6 Å.
Peptide aptamers consist of one or more peptide loops of variable sequence displayed by a protein scaffold. Derivatives known as tadpoles, in which peptide aptamer "heads" are covalently linked to unique sequence double-stranded DNA "tails", allow quantification of scarce target molecules in mixtures by PCR (using, for example, the quantitative real-time polymerase chain reaction) of their DNA tails. The peptides that form the aptamer variable regions are synthesized as part of the same polypeptide chain as the scaffold and are constrained at their N and C termini by linkage to it. This double structural constraint decreases the diversity of the 3D structures that the variable regions can adopt, and this reduction in structural diversity lowers the entropic cost of molecular binding when interaction with the target causes the variable regions to adopt a uniform structure.
Libraries of peptide aptamers have been used as "mutagens", in studies in which an investigator introduces a library that expresses different peptide aptamers into a cell population, selects for a desired phenotype, and identifies those aptamers that cause the phenotype. The investigator then uses those aptamers as baits, for example in yeast two-hybrid screens to identify the cellular proteins targeted by those aptamers. Such experiments identify particular proteins bound by the aptamers, and protein interactions that the aptamers disrupt, to cause the phenotype. In addition, peptide aptamers derivatized with appropriate functional moieties can cause specific post-translational modification of their target proteins, or change the subcellular localization of the targets.
Sources: en.wikipedia.org
It is a solid form of creatine that contains one water molecule per creatine molecule in the crystal lattice. The hydrate water is part of the crystal structure rather than loose moisture. The term is often used for the common crystalline powder grade.
Creatine anhydrous lacks the water of crystallization and therefore contains a higher creatine fraction by mass. The monohydrate is more common in commerce and research because it is stable and easy to handle. The two forms are not identical in solid state, though both yield creatine when dissolved.
Creatine is the base molecule, while creatine monohydrate is a hydrate of that molecule. Once dissolved, the hydrate water becomes part of the solvent and free creatine is present. In casual usage the names are often shortened to creatine, but the solid forms differ.
It is a crystalline form of creatine that contains one water molecule per creatine molecule. The compound occurs naturally in muscle tissue and is also produced synthetically for research and consumer products. The monohydrate label describes the solid's hydration state.