Everything below concerns Creatine monohydrate. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-02-25. Numbers and descriptions here follow the published literature rather than marketing material.
Creatine monohydrate is a crystalline organic compound formed from creatine and water in a one-to-one ratio. It belongs to the guanidino family and contains a methylated guanidine group attached to an acetate-like chain. The solid is commonly described as a white, odorless powder with a mildly bitter taste. Its molecular formula is C4H11N3O3·H2O, and the hydrated form is the most widely traded grade. The compound occurs naturally in vertebrate muscle and brain tissue, where it participates in rapid energy buffering.
In aqueous solution, creatine monohydrate exists mainly as a zwitterion, carrying both a positive guanidinium charge and a negative carboxylate charge. This charge separation raises water solubility relative to many neutral organic solids and helps explain its behavior in analytical separations. The monohydrate can lose its water of crystallization under sustained heat or low humidity, converting toward anhydrous creatine. Such transitions matter for mass balance calculations because the hydrate contributes water mass that is not part of the active creatine molecule.
Quality control of creatine monohydrate relies on a combination of identity, purity, and moisture tests. High-performance liquid chromatography with ultraviolet detection is widely used to separate creatine from creatinine and other related nitrogenous compounds. Spectroscopic methods such as infrared and nuclear magnetic resonance provide structural confirmation. Because the material is a hydrate, water content is measured separately, often by Karl Fischer titration. These tests together establish whether a lot meets a defined specification.
Manufacturing processes can leave trace amounts of dicyandiamide, creatinine, or residual solvents, depending on the synthetic route and purification steps. Heavy metals, arsenic, and microbial contamination are also monitored for food or pharmaceutical grades. Particle size distribution can affect dissolution behavior and blending uniformity, so it may be specified for certain applications. Analytical results are reported on a dry basis or as-is basis, and the difference matters when comparing certificates of analysis. Open questions remain about how minor impurities influence long-term stability under varied storage conditions.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C4H11N3O3·H2O | Hydrated form includes one water molecule per creatine unit. |
| Molar mass | 149.15 g/mol | Calculated for the monohydrate form. |
| Appearance | White crystalline powder | Common commercial grade is odorless or nearly odorless. |
| Solubility in water | Moderately soluble | Solubility increases with temperature and depends on pH. |
| Common synonyms | Creatine hydrate; N-methylguanidinoacetic acid | Monohydrate distinguishes it from anhydrous creatine. |
A typical intracellular concentration of ATP is 1–10 μmol per gram of muscle tissue in a variety of eukaryotes. The dephosphorylation of ATP and rephosphorylation of ADP and AMP occur repeatedly in the course of aerobic metabolism. ATP can be produced by a number of distinct cellular processes; the three main pathways in eukaryotes are (1) glycolysis, (2) the citric acid cycle/oxidative phosphorylation, and (3) beta-oxidation. The overall process of oxidizing glucose to carbon dioxide, the combination of pathways 1 and 2, known as cellular respiration, produces about 30 equivalents of ATP from each molecule of glucose. ATP production by a non-photosynthetic aerobic eukaryote occurs mainly in the mitochondria, which comprise nearly 25% of the volume of a typical cell.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
A lot of effort has been put into controlling cell selectivity. For example, attempts have been made to modify and optimize the physicochemical parameters of the peptides to control the selectivities, including net charge, helicity, hydrophobicity per residue (H), hydrophobic moment (μ) and the angle subtended by the positively charged polar helix face (Φ). Other mechanisms like the introduction of D-amino acids and fluorinated amino acids in the hydrophobic phase are believed to break the secondary structure and thus reduce hydrophobic interaction with mammalian cells. It has also been found that Pro→Nlys substitution in Pro-containing β-turn antimicrobial peptides was a promising strategy for the design of new small bacterial cell-selective antimicrobial peptides with intracellular mechanisms of action. It has been suggested that direct attachment of magainin to the substrate surface decreased nonspecific cell binding and led to improved detection limit for bacterial cells such as Salmonella and E. coli.
Sources: en.wikipedia.org
APHL works with public health partners to build the foundation for quality testing, comprehensive standards and integrated public health laboratory systems. One of the initiatives, the Laboratory System Improvement Program, provides individual assessments of public health laboratory systems that include engaging stakeholders for system improvement, performance, implementation of strategies and continual evaluation. APHL also collaborates on the National Laboratory System project to build a public-private network of laboratories nationwide. APHL monitors trends in public health laboratory diagnostics, personnel and infrastructure in order to create quality assurance standards. By using these data points to benchmark individual labs against national norms, APHL is able to home in on key issues and help raise the standard of laboratory systems. Member labs have access to research and survey data online, which enables them to leverage new information quickly to identify promising strategies and practices.
The first National Air Pollution Symposium in the United States was held in 1949 and hosted by Stanford Research Institute (now SRI International). At first, smaller governments were responsible for the passage and enforcement of such legislation. The main purpose of the Air Pollution Control Act of 1955 was to provide research assistance to find a way to control air pollution from its source. A total of $5 million was granted to the public health service for a five-year period to conduct this research. According to a private website, the amount was $3 million allotted per year for the five-year period of research.
The main etiologic factor of ACC is unknown, although families with Li–Fraumeni syndrome, caused by an inherited inactivation mutation in TP53, have increased risk. Several genes have been shown to be recurrently mutated, including TP53, CTNNB1, MEN1, PRKAR1A, RPL22, and DAXX. The telomerase gene TERT is often amplified while ZNRF3 and CDKN2A are often homozygously deleted. The genes h19, insulin-like growth factor II (IGF-II), and p57kip2 are important for fetal growth and development. They are located on chromosome 11p. Expression of the h19 gene is markedly reduced in both nonfunctioning and functioning adrenal cortical carcinomas, especially in tumors producing cortisol and aldosterone. Also, a loss occurs of activity of the p57kip2 gene product in virilizing adenomas and adrenal cortical carcinomas. In contrast, IGF-II gene expression has been shown to be high in adrenal cortical carcinomas. Finally, c-myc gene expression is relatively high in neoplasms, and it is often linked to poor prognosis. Bilateral adrenocortical tumors are less common than unilateral. The majority of bilateral tumours can be distinguished according to size and aspect of the nodules: primary pigmented nodular adrenocortical disease, which can be sporadic or part of Carney complex, and primary bilateral macro nodular adrenal hyperplasia.Metastasis is most commonly to the liver and lung.
Sources: en.wikipedia.org
In common usage, yes, but technically creatine monohydrate is one specific hydrated salt form. Other creatine forms exist and differ in composition and properties. The monohydrate is the most studied and most widely available grade.
Yes. Each creatine molecule in the crystal is associated with one water molecule. That water contributes to the total mass but is not part of the creatine molecule itself. Heating or drying can remove some or all of this water.
It occurs naturally in meat and fish, and the human body also makes and stores creatine. Food sources provide varying amounts depending on the type and preparation. The compound is not considered an essential dietary nutrient for adults because the body can synthesize it.
Purity is commonly assessed by HPLC, which separates creatine from related compounds such as creatinine. Water content is measured separately by Karl Fischer titration. Together these results help calculate the actual creatine content in a sample.