monohydrate is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-05-09. Numbers and descriptions here follow the published literature rather than marketing material.
Commercial creatine monohydrate is typically manufactured through chemical synthesis, often starting from sarcosine and cyanamide. The resulting material is crystallized, washed, and dried to a specified hydrate content. Finished lots are tested for identity, purity, moisture, and heavy metals before release. Because the compound can cyclize to creatinine under heat or prolonged storage in solution, manufacturers control temperature and humidity during processing. The solid itself is relatively stable when kept dry and sealed, but moisture uptake can cause caking and complicate accurate assay.
Analytical laboratories commonly identify creatine monohydrate by high-performance liquid chromatography with ultraviolet detection, often after dissolving the sample in water or dilute acid. Ion-exchange or reversed-phase columns separate creatine from creatinine and related guanidino compounds. Nitrogen content can be checked by Kjeldahl or combustion methods, while moisture is measured by Karl Fischer titration or loss on drying. These techniques give complementary views: chromatographic purity addresses related substances, whereas moisture and elemental data confirm hydrate stoichiometry. No single test defines quality by itself; a combination is used in specifications.
Storage recommendations generally emphasize a cool, dry place away from direct sunlight and strong oxidizers. Sealed containers limit humidity exchange, which helps prevent clumping and gradual conversion to creatinine. Long-term stability studies usually monitor appearance, moisture, and purity at intervals under defined temperature and humidity conditions. Accelerated tests at elevated temperature can reveal degradation pathways, but they do not perfectly predict room-temperature shelf life. Questions remain about how much creatinine formation is acceptable in different product categories and how packaging choices affect that rate over time.
Identity and purity are assessed with several complementary methods. High-performance liquid chromatography can separate creatine from creatinine and related impurities, often with ultraviolet detection. Nuclear magnetic resonance and infrared spectroscopy provide structural confirmation, while Karl Fischer titration measures water content. Elemental analysis and mass spectrometry may be used for additional confirmation, especially in research or forensic settings. No single method captures every quality attribute, so laboratories typically combine results and compare them against a specification.
Creatine monohydrate is sold as a dietary ingredient in some countries and as a food supplement in others. Regulatory frameworks vary, so purity limits, labeling rules, and permitted claims are not globally uniform. In the United States, it falls under dietary supplement rules, whereas the European Union treats it as a food supplement ingredient. Pharmacopeial monographs, where they exist, can provide public quality standards, but not every product is required to meet them. Questions about long-term effects and patterns of use remain areas of active study rather than settled regulatory findings.
| Property | Value | Notes |
|---|---|---|
| Common analytical method | HPLC-UV | Separation from creatinine and related compounds. |
| Moisture content | Typically 12% theoretical | Monohydrate stoichiometry corresponds to about 12% water by mass. |
| Typical storage temperature | 15–25 °C | Cool, dry, sealed conditions limit moisture uptake. |
| Degradation marker | Creatinine | Formed by cyclization, especially in solution or with heat. |
| Solubility class | Moderately soluble in water | Solubility rises with temperature and varies with pH. |
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Creatine itself is a nitrogen-containing organic acid that occurs in vertebrate muscle and other tissues. The monohydrate designation refers to the water included in the crystal lattice, not to water added during manufacturing. Its chemical formula is commonly written as C4H9N3O2·H2O. The solid is typically a white, odorless powder with low solubility in water at room temperature. It is one of several creatine forms described in scientific and commercial literature.
The compound was identified in the nineteenth century after chemists isolated a nitrogenous substance from meat extracts. Later work established its role in muscle energy metabolism and its conversion to phosphocreatine. Chemical synthesis of creatine followed, and industrial production made the monohydrate widely available as a purified powder. Interest expanded in the late twentieth century when researchers began studying creatine supplementation and muscle physiology. Historical accounts sometimes differ on exact dates and attributions, but the broad sequence from tissue extracts to synthetic production is well documented.
In the body, creatine is obtained from dietary meat and fish and is also synthesized from arginine, glycine, and methionine. Muscle stores creatine and phosphocreatine, which participate in the rapid regeneration of adenosine triphosphate during short, intense activity. The monohydrate form is used in research because it is chemically defined, stable as a dry solid, and relatively inexpensive to produce. Questions remain about whether other creatine forms offer meaningful advantages in absorption or tissue retention, and findings vary across studies and populations.
Analytical methods for creatine monohydrate focus on identity, purity, and degradation products. High-performance liquid chromatography with ultraviolet detection is common, often at a wavelength near 210 nanometers. Titration and nuclear magnetic resonance spectroscopy can also quantify the parent compound. Pharmacopeial monographs specify tests for appearance, solubility, water content, and related substances, including creatinine. Purity values above 99 percent are typical for pharmaceutical-grade material, though supplement-grade products vary. Independent verification can detect label discrepancies.
Sourcing and verification of creatine monohydrate involve both manufacturing origin and third-party testing. Industrial production commonly starts with sarcosine and cyanamide, followed by crystallization to obtain the monohydrate. Some products are derived from animal sources, while others are synthesized from non-animal precursors. Certificates of analysis report assay, heavy metals, and microbial limits. Regulations differ by country: in the United States it is sold as a dietary supplement, whereas in the European Union it falls under food supplement rules.
In solid form, creatine monohydrate is relatively stable when kept dry and away from heat. Moisture and elevated temperatures promote cyclization into creatinine, a related compound with no role in the phosphagen system. Degradation accelerates in aqueous solution, where the conversion can occur within hours to days depending on pH and temperature. Manufacturers typically recommend storage in sealed containers at room temperature, with relative humidity below 50 percent. Long-term stability data for opened containers are limited.
Commercial creatine monohydrate is typically a white to off-white powder with low odor. It is commonly sold as a fine powder, micronized powder, or larger crystals, but these are physical forms of the same chemical. Purity grades vary, and products may contain small amounts of related substances such as creatinine, dicyandiamide, or moisture. The monohydrate is often selected for supplements and research because its production is well established and its behavior in water is predictable. Analytical certificates usually report assay, loss on drying, and heavy metals.
Creatine monohydrate is a crystalline compound formed from creatine and one water molecule in its solid lattice. Creatine itself is a nitrogen-containing organic acid involved in energy transfer in muscle and other tissues. The monohydrate form is the most common solid form used in research and commercial products because it is stable and easy to handle. The term "monohydrate" refers to the fixed one-to-one ratio of water to creatine in the crystal, not to moisture content. This distinction matters when comparing labels or calculating creatine content.
In chemical terms, creatine monohydrate is often described as N-(aminoiminomethyl)-N-methylglycine monohydrate, though nomenclature varies. Its solid state consists of zwitterionic creatine molecules linked with water through hydrogen bonding. The compound dissolves in water, but dissolution rate depends on particle size, temperature, and agitation. Once dissolved, the hydrate water becomes part of the solvent, leaving free creatine in solution. The monohydrate is not the same as creatine anhydrous, which lacks the water of crystallization and has a higher creatine fraction by mass.
H3A (aq) + H2O (l) ⇌ H3O+ (aq) + H2A− (aq) Ka1 H2A− (aq) + H2O (l) ⇌ H3O+ (aq) + HA2− (aq) Ka2 HA2− (aq) + H2O (l) ⇌ H3O+ (aq) + A3− (aq) Ka3 An inorganic example of a triprotic acid is orthophosphoric acid (H3PO4), usually just called phosphoric acid. All three protons can be successively lost to yield H2PO−4, then HPO2−4, and finally PO3−4, the orthophosphate ion, usually just called phosphate. Even though the positions of the three protons on the original phosphoric acid molecule are equivalent, the successive Ka values differ since it is energetically less favorable to lose a proton if the conjugate base is more negatively charged. An organic example of a triprotic acid is citric acid, which can successively lose three protons to finally form the citrate ion. Although the subsequent loss of each hydrogen ion is less favorable, all of the conjugate bases are present in solution. The fractional concentration, α (alpha), for each species can be calculated. For example, a generic diprotic acid will generate 3 species in solution: H2A, HA−, and A2−. The fractional concentrations can be calculated as below when given either the pH (which can be converted to the [H+]) or the concentrations of the acid with all its conjugate bases:
Activated carbon, in 50% w/w combination with celite, is used as stationary phase in low-pressure chromatographic separation of carbohydrates (mono-, di-, tri-saccharides) using ethanol solutions (5–50%) as mobile phase in analytical or preparative protocols. Activated carbon is useful for extracting the direct oral anticoagulants (DOACs) such as dabigatran, apixaban, rivaroxaban and edoxaban from blood plasma samples. For this purpose it has been made into "minitablets", each containing 5 mg activated carbon for treating 1ml samples of DOAC. Since this activated carbon has no effect on blood clotting factors, heparin or most other anticoagulants this allows a plasma sample to be analyzed for abnormalities otherwise affected by the DOACs. Carbon adsorption has numerous applications in removing pollutants from air or water streams both in the field and in industrial processes such as:
A carboxylic acid has the general formula R-C(O)OH, where R is an organic radical. The carboxyl group -C(O)OH contains a carbonyl group, C=O, and a hydroxyl group, O-H. Acetic acid (CH3COOH) Citric acid (C6H8O7) Formic acid (HCOOH) Gluconic acid HOCH2-(CHOH)4-COOH Lactic acid (CH3-CHOH-COOH) Oxalic acid (HOOC-COOH) Tartaric acid (HOOC-CHOH-CHOH-COOH) Halogenation at alpha position increases acid strength, so that the following acids are all stronger than acetic acid. Fluoroacetic acid Trifluoroacetic acid Chloroacetic acid Dichloroacetic acid Trichloroacetic acid Normal carboxylic acids are the direct union of a carbonyl group and a hydroxyl group. In vinylogous carboxylic acids, a carbon-carbon double bond separates the carbonyl and hydroxyl groups. Ascorbic acid Deoxyribonucleic acid (DNA) Ribonucleic acid (RNA) Listing of strengths of common acids and bases Zumdahl, Steven S. (1997). Chemistry (4th ed.). Boston: Houghton Mifflin. ISBN 9780669417944. Pavia, D. L.; Lampman, G. M.; Kriz, G. S. (2004). Organic Chemistry Volume I. Mason, OH: Cengage Learning. ISBN 0759347271.
3-phosphoglycerate can be separated and measured using paper chromatography as well as with column chromatography and other chromatographic separation methods. It can be identified using both gas-chromatography and liquid-chromatography mass spectrometry and has been optimized for evaluation using tandem MS techniques. 2-Phosphoglyceric acid Calvin-Benson cycle Photosynthesis Ribulose 1,5-bisphosphate
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Acids play important roles in the human body. The hydrochloric acid present in the stomach aids digestion by breaking down large and complex food molecules. Amino acids are required for synthesis of proteins required for growth and repair of body tissues. Fatty acids are also required for growth and repair of body tissues. Nucleic acids are important for the manufacturing of DNA and RNA and transmitting of traits to offspring through genes. Carbonic acid is important for maintenance of pH equilibrium in the body. Human bodies contain a variety of organic and inorganic compounds, among those dicarboxylic acids play an essential role in many biological behaviors. Many of those acids are amino acids, which mainly serve as materials for the synthesis of proteins. Other weak acids serve as buffers with their conjugate bases to keep the body's pH from undergoing large scale changes that would be harmful to cells. The rest of the dicarboxylic acids also participate in the synthesis of various biologically important compounds in human bodies.
The word "aptamer" is a neologism coined by Andrew D. Ellington and Jack Szostak in their first publication on the topic. They did not provide a precise definition, stating "We have termed these individual RNA sequences 'aptamers', from the Latin aptus, to fit." The word itself, however, derives from the Greek word ἅπτω, to connect or fit (as used by Homer (c. 8th century BC)) and μέρος, a component of something larger. A typical aptamer is a synthetically generated ligand exploiting the combinatorial diversity of DNA, RNA, XNA, or peptide to achieve strong, specific binding for a particular target molecule or family of target molecules. Aptamers are occasionally classified as "chemical antibodies" or "antibody mimics". However, most aptamers are small, with a molecular weight of 6-30 kDa, in contrast to the 150 kDa size of antibodies, and contain one binding site rather than the two matching antigen binding regions of a typical antibody.
Sources: en.wikipedia.org
Laboratories typically combine chromatographic separation with moisture and elemental analysis. High-performance liquid chromatography can quantify creatine and related substances such as creatinine. Moisture methods confirm the hydrate form and help detect excess water.
The dry crystalline solid is relatively stable when protected from moisture and heat. In solution, it can convert to creatinine over time, especially at higher temperatures. Storage conditions and product form influence the rate of change.
Moisture uptake can cause particles to stick together, particularly in humid conditions or after opening a container. Clumping does not necessarily mean the creatine has degraded. It can make accurate measuring more difficult, so dry storage and sealed packaging are used.
A sealed container kept at room temperature and away from moisture is typical. Heat and humidity promote conversion to creatinine and can reduce assay values. Long-term storage under dry conditions helps maintain the original crystalline form.